HPA001894

GPKOW antibody from Sigma-Aldrich
GPATC5, GPATCH5, Spp2, T54
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA001894
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA001894, RRID:AB_1079014
Product name
Anti-GPKOW antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA001894
Antibody type
Polyclonal
Antigen
G patch domain and KOW motifs-containing protein recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
MPRPDEEQEKDKEDQPQGLVPGGAVVVLSGPHRGL
YGKVEGLDPDNVRAMVRLAVGSRVVTVSEYYLRPV
SQQEFDKNTLDLRQQNGTASSRKTLWNQELYIQQD
NSERKRKHLPD
Storage
-20C
Provider Type Product Number
- No reagents -