Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- Immunocytochemistry [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- PAB22510 - Provider product page 
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#PAB22510, RRID:AB_10965873
- Product name
- ZC3H15 polyclonal antibody
- Antibody type
- Polyclonal
- Description
- Rabbit polyclonal antibody raised against recombinant ZC3H15.
- Antigen sequence
- AWKKRKRQEKIDKLEQDMERRKADFKAGKALVISG
 REVFEFRPELVNDDDEEADDTRYTQGTGGDEVDDS
 VSVND
- Isotype
- IgG
- Storage
- Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
				No comments: Submit comment	
	
			
							
					Supportive validation
					
									
				
				- Submitted by
- Abnova Corporation (provider)
- Main image
 
- Experimental details
- Western blot analysis of Lane 1: RT-4, Lane 2: U-251 MG, Lane 3: Human Plasma, Lane 4: Liver, Lane 5: Tonsil with ZC3H15 polyclonal antibody (Cat # PAB22510).
							
					Supportive validation
					
									
				
				- Submitted by
- Abnova Corporation (provider)
- Main image
 
- Experimental details
- Immunofluorescent staining of human cell line U-2 OS with ZC3H15 polyclonal antibody (Cat # PAB22510) at 1-4 ug/mL dilution shows positivity in nucleus but not nucleoli and cytoplasm.
- Validation comment
- Immunofluorescence
							
					Supportive validation
					
									
				
		- Submitted by
- Abnova Corporation (provider)
- Main image
 
- Experimental details
- Immunohistochemical staining of human rectum with ZC3H15 polyclonal antibody (Cat # PAB22510) strong cytoplasmic positivity in glandular cells at 1:50-1:200 dilution.
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)