HPA031101

ZC3H15 antibody from MilliporeSigma / Merck KGaA
LEREPO4
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA031101
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA031101, RRID:AB_10611669
Product name
Anti-ZC3H15 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA031101
Antibody type
Polyclonal
Antigen
zinc finger CCCH-type containing 15 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LNELFKPVVAAQKISKGADPKSVVCAFFKQGQCTK
GDKCKFSHDLTLERKCEKRSVYIDARDEELEKDTM
DNWDEKKLEEVVNKKHGE
Storage
-20C
Provider Type Product Number
- No reagents -