Antibody data
- Antibody Data
- Antigen structure
- References [3]
- Comments [0]
- Validations
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA026441 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA026441, RRID:AB_1844711
- Product name
- Anti-AKT3
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
EEREEWTEAIQAVADRLQRQEEERMNCSPTSQIDN
IGEEEMDASTTHHKRKTMNDFDYLKLL- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references
Investigation of molecular alterations of
in triple-negative breast cancer
Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells
Abrogation of BRAFV600E-induced senescence by PI3K pathway activation contributes to melanomagenesis.
O'Hurley G, Daly E, O'Grady A, Cummins R, Quinn C, Flanagan L, Pierce A, Fan Y, Lynn M, Rafferty M, Fitzgerald D, Pontén F, Duffy M, Jirström K, Kay E, Gallagher W
Histopathology 2014 April;64(5):660-670
Histopathology 2014 April;64(5):660-670
Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells
Stadler C, Rexhepaj E, Singan V, Murphy R, Pepperkok R, Uhlén M, Simpson J, Lundberg E
Nature Methods 2013 February;10(4):315-323
Nature Methods 2013 February;10(4):315-323
Abrogation of BRAFV600E-induced senescence by PI3K pathway activation contributes to melanomagenesis.
Vredeveld LC, Possik PA, Smit MA, Meissl K, Michaloglou C, Horlings HM, Ajouaou A, Kortman PC, Dankort D, McMahon M, Mooi WJ, Peeper DS
Genes & development 2012 May 15;26(10):1055-69
Genes & development 2012 May 15;26(10):1055-69
No comments: Submit comment
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human cerebral cortex shows strong nuclear and cytoplasmic positivity in neuronal cells.
- Sample type
- HUMAN