HPA026441

AKT3 antibody from Sigma-Aldrich
PKBG, PRKBG, RAC-gamma
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA026441
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA026441, RRID:AB_1844711
Product name
Anti-AKT3 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA026441
Antibody type
Polyclonal
Antigen
RAC-gamma serine/threonine-protein kinase recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
EEREEWTEAIQAVADRLQRQEEERMNCSPTSQIDN
IGEEEMDASTTHHKRKTMNDFDYLKLL
Storage
-20C
Provider Type Product Number
- No reagents -