ABIN504605

INSR antibody from antibodies-online
CD220
Western blot
Data presented on provider website
Immunohistochemistry
Recommended by provider

Antibody data

Product number
ABIN504605
Provider
antibodies-online
Product name
anti-Insulin Receptor (INSR) (Middle Region) antibody
Provider product page
antibodies-online - ABIN504605
Antibody type
Polyclonal
Antigen
The immunogen for anti-INSR antibody: synthetic peptide directed towards the middle region of human INSR
Description
Affinity Purified
Reactivity
Human, Mouse, Rat, Canine, Rabbit, Xenopus, Zebrafish
Host
Rabbit
Antigen sequence
SSHCQREEAGGRDGGSSLGFKRSYEEHIPYTHMNG
GKKNG RILTLPRSNP
Epitope
Middle Region
Vial size
50 μg
Concentration
1mg/mL
Storage
-20°C
Handling
Avoid repeated freeze-thaw cycles.
Provider Type Product Number
- No reagents -