H00002029-M01A

ENSA antibody from Abnova Corporation
ARPP-19e, MGC4319, MGC78563, MGC8394

Antibody data

Product number
H00002029-M01A
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00002029-M01A, RRID:AB_1574684
Product name
ENSA monoclonal antibody (M01A), clone 1E8
Provider product page
Abnova Corporation - H00002029-M01A
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a full-length recombinant ENSA.
Antigen sequence
MSQKQEEENPAEETGEEKQDTQEKEGILPERAEEA
KLKAKYPSLGQKPGGSDFLMKRLQKGQKYFDSGDY
NMAKAKMKNKQLPSAGPDKNLVTGDHIPTPQDLPQ
RKSSLVTSKLAGGQVE
Isotype
IgG
Antibody clone number
1E8
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -