Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA028558 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA028558, RRID:AB_10601656
- Product name
- Anti-GOLPH3L
- Antibody type
- Polyclonal
- Description
- Affinity purified using the PrEST antigen as affinity ligand
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
QRMDKRTLALLVLAHSSDVLENVFSSLTDDKYDVA
MNRAKDLVELDPEVEGTKPSATEMIWAVLAAFNKS- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Mitochondria “fuel” breast cancer metabolism: Fifteen markers of mitochondrial biogenesis label epithelial cancer cells, but are excluded from adjacent stromal cells
Sotgia F, Whitaker-Menezes D, Martinez-Outschoorn U, Salem A, Tsirigos A, Lamb R, Sneddon S, Hulit J, Howell A, Lisanti M
Cell Cycle 2014;11(23):4390-4401
Cell Cycle 2014;11(23):4390-4401
No comments: Submit comment
No validations: Submit validation data