Antibody data

Product number
H00003628-M11A
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00003628-M11A, RRID:AB_1237752
Product name
INPP1 monoclonal antibody (M11A), clone 4F9
Provider product page
Abnova Corporation - H00003628-M11A
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant INPP1.
Antigen sequence
GLVDIYIFSEDTTFKWDSCAAHAILRAMGGGIVDL
KECLERNPETGLDLPQLVYHVENEGAAGVDRWANK
GGLIAYRSRKRLETFLSLLVQNLAPAETHT
Isotype
IgG
Antibody clone number
4F9
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -