Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00001513-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00001513-M01, RRID:AB_606105
- Product name
- CTSK monoclonal antibody (M01), clone 2F1
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant CTSK.
- Antigen sequence
KCRGYREIPEGNEKALKRAVARVGPVSVAIDASLT
SFQFYSKGVYYDESCNSDNLNHAVLAVGYGIQKGN
KHWIIKNSWGENWGNKGYILMARNKNNACGIANLA
SFPKM- Isotype
- IgG
- Antibody clone number
- 2F1
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Simultaneous expression of Cathepsins B and K in pulmonary adenocarcinomas and squamous cell carcinomas predicts poor recurrence-free and overall survival.
Cordes C, Bartling B, Simm A, Afar D, Lautenschläger C, Hansen G, Silber RE, Burdach S, Hofmann HS
Lung cancer (Amsterdam, Netherlands) 2009 Apr;64(1):79-85
Lung cancer (Amsterdam, Netherlands) 2009 Apr;64(1):79-85
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of CTSK expression in transfected 293T cell line by CTSK monoclonal antibody (M01), clone 2F1.Lane 1: CTSK transfected lysate(37 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged CTSK is approximately 3ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoperoxidase of monoclonal antibody to CTSK on formalin-fixed paraffin-embedded human kidney. [antibody concentration 3 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol