Antibody data
- Antibody Data
- Antigen structure
- References [4]
- Comments [0]
- Validations
- ELISA [1]
- Immunocytochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00002744-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00002744-M01, RRID:AB_509247
- Product name
- GLS monoclonal antibody (M01), clone 5C4
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant GLS.
- Antigen sequence
EQRDYDSRTALHVAAAEGHVEVVKFLLEACKVNPF
PKDRWNNTPMDEALHFGHHDVFKILQEYQVQYTPQ
GDSDNGKENQTVHKNLDGLL- Isotype
- IgG
- Antibody clone number
- 5C4
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Control of glutamine metabolism by the tumor suppressor Rb.
Combination of neonatal PolyI:C and adolescent phencyclidine treatments is required to induce behavioral abnormalities with overexpression of GLAST in adult mice.
Mitochondrial localization and structure-based phosphate activation mechanism of Glutaminase C with implications for cancer metabolism.
Premature senescence of human endothelial cells induced by inhibition of glutaminase.
Reynolds MR, Lane AN, Robertson B, Kemp S, Liu Y, Hill BG, Dean DC, Clem BF
Oncogene 2014 Jan 30;33(5):556-66
Oncogene 2014 Jan 30;33(5):556-66
Combination of neonatal PolyI:C and adolescent phencyclidine treatments is required to induce behavioral abnormalities with overexpression of GLAST in adult mice.
Hida H, Mouri A, Ando Y, Mori K, Mamiya T, Iwamoto K, Ozaki N, Yamada K, Nabeshima T, Noda Y
Behavioural brain research 2014 Jan 1;258:34-42
Behavioural brain research 2014 Jan 1;258:34-42
Mitochondrial localization and structure-based phosphate activation mechanism of Glutaminase C with implications for cancer metabolism.
Cassago A, Ferreira AP, Ferreira IM, Fornezari C, Gomes ER, Greene KS, Pereira HM, Garratt RC, Dias SM, Ambrosio AL
Proceedings of the National Academy of Sciences of the United States of America 2012 Jan 24;109(4):1092-7
Proceedings of the National Academy of Sciences of the United States of America 2012 Jan 24;109(4):1092-7
Premature senescence of human endothelial cells induced by inhibition of glutaminase.
Unterluggauer H, Mazurek S, Lener B, Hütter E, Eigenbrodt E, Zwerschke W, Jansen-Dürr P
Biogerontology 2008 Aug;9(4):247-59
Biogerontology 2008 Aug;9(4):247-59
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged GLS is approximately 0.3ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunofluorescence of monoclonal antibody to GLS on HeLa cell. [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol