HPA028404

ANXA9 antibody from MilliporeSigma / Merck KGaA
ANX31
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA028404
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA028404, RRID:AB_10599190
Product name
Anti-ANXA9 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA028404
Antibody type
Polyclonal
Antigen
annexin A9 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
NLERIVMALLQPTAQFDAQELRTALKASDSAVDVA
IEILATRTPPQLQECLAVYKHNFQVEAVDDITSET
SGIL
Storage
-20C
Provider Type Product Number
- No reagents -