HPA028351

MINDY1 antibody from Sigma-Aldrich
FAM63A, FLJ11280, MINDY-1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA028351
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA028351, RRID:AB_10611110
Product name
Anti-FAM63A antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA028351
Antibody type
Polyclonal
Antigen
family with sequence similarity 63, member A recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
FPSYWTGHSFASQAWLRQVPEVSKHLQCPSAESLL
TMEYHQPEDPAPGKAGTAEAVIPENHEVLAGPDEH
PQDTDARDADGEAREREPADQALLPSQ
Storage
-20C
Provider Type Product Number
- No reagents -