HPA028411

PRUNE1 antibody from MilliporeSigma / Merck KGaA
DRES-17, H-PRUNE, HTCD37, PRUNE
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA028411
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA028411, RRID:AB_10603229
Product name
Anti-PRUNE antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA028411
Antibody type
Polyclonal
Antigen
prune homolog (Drosophila) recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LERSHSPPLKLTPASSTHPNLHAYLQGNTQVSRKK
LLPLLQEALSAYFDSMKIPSGQPETADVSREQ
Storage
-20C
Provider Type Product Number
- No reagents -