HPA035232

RFTN2 antibody from Atlas Antibodies
C2orf11, FLJ30574, Raftlin-2

Antibody data

Product number
HPA035232
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA035232, RRID:AB_10601495
Product name
Anti-RFTN2
Provider product page
Atlas Antibodies - HPA035232
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
NVAAKRGMKFVGFISQHYSPSKFCNGTNHDGDIES
MLHVRHGSDENCRSWNEGTLSGQSSESGIEEELHH
ESGQYQMEQNGSPTSSKSRKGE
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.