HPA031849

PLCL1 antibody from MilliporeSigma / Merck KGaA
PLC-L, PLCE, PLCL, PPP1R127, PRIP
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA031849
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA031849, RRID:AB_10602192
Product name
Anti-PLCL1 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA031849
Antibody type
Polyclonal
Antigen
phospholipase C-like 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LRYLVSRSKQPLDFMEGNQNTPRFMWLKTVFEAAD
VDGNGIMLEDTSVELIKQLNPTLKEAKIRLKFKEI
QKSKEKLTTRVTEEEF
Storage
-20C
Provider Type Product Number
- No reagents -