HPA027646

THEM5 antibody from Sigma-Aldrich
FLJ37964
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA027646
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA027646, RRID:AB_10603215
Product name
Anti-THEM5 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA027646
Antibody type
Polyclonal
Antigen
thioesterase superfamily member 5 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
VEGQGFEYVIFFQPTQKKSVCLFQPGSYLEGPPGF
AHGGSLAAMMDETFSKTAFLAGEGLFTLSLN
Storage
-20C
Provider Type Product Number
- No reagents -