Antibody data
- Antibody Data
- Antigen structure
- References [7]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
- Immunohistochemistry [1]
- Proximity ligation assay [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00002316-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00002316-M01, RRID:AB_425437
- Product name
- FLNA monoclonal antibody (M01), clone 4E10-1B2
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a full length recombinant FLNA.
- Antigen sequence
MPSGKVAQPTITDNKDGTVTVRYAPSEAGLHEMDI
RYDNMHIPGSPLQFYVDYVNCGHVTAYGPGLTHGV
VNKPATFTVNTKDAGEGGLSLAIEGPSKAEISCTD
NQDGTCSVSYLPVLPGDYSILVKYNEQHVPGSPFT
ARVTGDDSMRMSHLKVGSAADIPINISETDLSLLT
ATVVPPSGREEPCLLKRLRNGHVGISFVPKETGEH
LVHVKKNGQHVASSPIPVVISQSEIGDASRVRVSG
QGLHEGHTFEPAEFIIDTRDAGYGGLSLSIEGPSK
VDINTEDLEDGTCRVTYCPTEPGNYIINIKFADQH
VPGSPFSVKVTGEGRVKESITRRRRAPSVANVGSH
CDLSLKIPEISIQDMTAQVTSPSGKTHEAEIVEGE
NHTYCIRFVPAEMGTHTVSVKYKGQHVPGSPFQFT
VGPLGEGGAHKVRAGGPGLERAEAGVPAEFSIWTR
EAGAGGLAIAVEGPSKAEISFEDRKDGSCGVAYVV
QEPGDYEVSVKFNEEHIPDSPFVVPVASPSGDARR
LTVSSLQESGLKVNQPASFAVSLNGAKGAIDAKVH
SPSGALEECYVTEIDQDKYAVRFIPRENGVYLIDV
KFNGTHIPGSPFKIRVGEPGHGGDPGLVSAYGAGL
EGGVTGNPAEFVVNTSNAGAGALSVTIDGPSKVKM
DCQECPEGYRVTYTPMAPGSYLISIKYGGPYHIGG
SPFKAKVTGPRLVSNHSLHETSSVFVDSLTKATCA
PQHGAPGPGPADASKVVAKGLGLSKAYVGQKSSFT
VDCSKAGNNMLLVGVHGPRTPCEEILVKHVGSRLY
SVSYLLKDKGEYTLVVKWGDEHIPGSPYRVVVP- Isotype
- IgG
- Antibody clone number
- 4E10-1B2
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Fibrinogen-like protein 2/fibroleukin induces long-term allograft survival in a rat model through regulatory B cells.
Familial periventricular nodular heterotopia, epilepsy and Melnick-Needles Syndrome caused by a single FLNA mutation with combined gain-of-function and loss-of-function effects.
Filamin A (FLNA) plays an essential role in somatostatin receptor 2 (SST2) signaling and stabilization after agonist stimulation in human and rat somatotroph tumor cells.
Junctional Rab13-binding protein (JRAB) regulates cell spreading via filamins.
Novel no-stop FLNA mutation causes multi-organ involvement in males.
Filamin-A is essential for dopamine d2 receptor expression and signaling in tumorous lactotrophs.
Mutations in TMEM216 perturb ciliogenesis and cause Joubert, Meckel and related syndromes.
Bézie S, Picarda E, Tesson L, Renaudin K, Durand J, Ménoret S, Mérieau E, Chiffoleau E, Guillonneau C, Caron L, Anegon I
PloS one 2015;10(3):e0119686
PloS one 2015;10(3):e0119686
Familial periventricular nodular heterotopia, epilepsy and Melnick-Needles Syndrome caused by a single FLNA mutation with combined gain-of-function and loss-of-function effects.
Parrini E, Mei D, Pisanti MA, Catarzi S, Pucatti D, Bianchini C, Mascalchi M, Bertini E, Morrone A, Cavaliere ML, Guerrini R
Journal of medical genetics 2015 Jun;52(6):405-12
Journal of medical genetics 2015 Jun;52(6):405-12
Filamin A (FLNA) plays an essential role in somatostatin receptor 2 (SST2) signaling and stabilization after agonist stimulation in human and rat somatotroph tumor cells.
Peverelli E, Giardino E, Treppiedi D, Vitali E, Cambiaghi V, Locatelli M, Lasio GB, Spada A, Lania AG, Mantovani G
Endocrinology 2014 Aug;155(8):2932-41
Endocrinology 2014 Aug;155(8):2932-41
Junctional Rab13-binding protein (JRAB) regulates cell spreading via filamins.
Sakane A, Alamir Mahmoud Abdallah A, Nakano K, Honda K, Kitamura T, Imoto I, Matsushita N, Sasaki T
Genes to cells : devoted to molecular & cellular mechanisms 2013 Sep;18(9):810-22
Genes to cells : devoted to molecular & cellular mechanisms 2013 Sep;18(9):810-22
Novel no-stop FLNA mutation causes multi-organ involvement in males.
Oegema R, Hulst JM, Theuns-Valks SD, van Unen LM, Schot R, Mancini GM, Schipper ME, de Wit MC, Sibbles BJ, de Coo IF, Nanninga V, Hofstra RM, Halley DJ, Brooks AS
American journal of medical genetics. Part A 2013 Sep;161A(9):2376-84
American journal of medical genetics. Part A 2013 Sep;161A(9):2376-84
Filamin-A is essential for dopamine d2 receptor expression and signaling in tumorous lactotrophs.
Peverelli E, Mantovani G, Vitali E, Elli FM, Olgiati L, Ferrero S, Laws ER, Della Mina P, Villa A, Beck-Peccoz P, Spada A, Lania AG
The Journal of clinical endocrinology and metabolism 2012 Mar;97(3):967-77
The Journal of clinical endocrinology and metabolism 2012 Mar;97(3):967-77
Mutations in TMEM216 perturb ciliogenesis and cause Joubert, Meckel and related syndromes.
Valente EM, Logan CV, Mougou-Zerelli S, Lee JH, Silhavy JL, Brancati F, Iannicelli M, Travaglini L, Romani S, Illi B, Adams M, Szymanska K, Mazzotta A, Lee JE, Tolentino JC, Swistun D, Salpietro CD, Fede C, Gabriel S, Russ C, Cibulskis K, Sougnez C, Hildebrandt F, Otto EA, Held S, Diplas BH, Davis EE, Mikula M, Strom CM, Ben-Zeev B, Lev D, Sagie TL, Michelson M, Yaron Y, Krause A, Boltshauser E, Elkhartoufi N, Roume J, Shalev S, Munnich A, Saunier S, Inglehearn C, Saad A, Alkindy A, Thomas S, Vekemans M, Dallapiccola B, Katsanis N, Johnson CA, Attié-Bitach T, Gleeson JG
Nature genetics 2010 Jul;42(7):619-25
Nature genetics 2010 Jul;42(7):619-25
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- FLNA monoclonal antibody (M01), clone 4E10-1B2 Western Blot analysis of FLNA expression in HL-60 ( Cat # L014V1 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged FLNA is approximately 0.03ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoperoxidase of monoclonal antibody to FLNA on formalin-fixed paraffin-embedded human lymphoma tissue. [antibody concentration 1.5 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Proximity Ligation Analysis of protein-protein interactions between GP1BA and FLNA. HeLa cells were stained with anti-GP1BA rabbit purified polyclonal 1:1200 and anti-FLNA mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).
- Validation comment
- In situ Proximity Ligation Assay (Cell)