HPA001115

FLNA antibody from Sigma-Aldrich
ABP-280, FLN, FLN1, OPD1, OPD2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA001115
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA001115, RRID:AB_1078871
Product name
Anti-FLNA antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA001115
Antibody type
Polyclonal
Antigen
Filamin-A recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
IKFADQHVPGSPFSVKVTGEGRVKESITRRRRAPS
VANVGSHCDLSLKIPEISIQDMTAQVTSPSGKTHE
AEIVEGENHTYCIRFVPAEMGTHTVSVKYKGQHVP
GSPFQFTV
Storage
-20C
Provider Type Product Number
- No reagents -