Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00006707-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00006707-M01, RRID:AB_607091
- Product name
- SPRR3 monoclonal antibody (M01), clone 4A12
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a full length recombinant SPRR3.
- Antigen sequence
MSSYQQKQTFTPPPQLQQQQVKQPSQPPPQEIFVP
TTKEPCHSKVPQPGNTKIPEPGCTKVPEPGCTKVP
EPGCTKVPEPGCTKVPEPGCTKVPEPGYTKVPEPG
SIKVPDQGFIKFPEPGAIKVPEQGYTKVPVPGYTK
VPEPCPSTVTPGPAQQKTKQK- Isotype
- IgG
- Antibody clone number
- 4A12
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Identification and evaluation of potential forensic marker proteins in vaginal fluid by liquid chromatography/mass spectrometry.
Igoh A, Doi Y, Sakurada K
Analytical and bioanalytical chemistry 2015 Sep;407(23):7135-44
Analytical and bioanalytical chemistry 2015 Sep;407(23):7135-44
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of SPRR3 expression in transfected 293T cell line by SPRR3 monoclonal antibody (M01), clone 4A12.Lane 1: SPRR3 transfected lysate(18.2 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged SPRR3 is approximately 0.03ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoperoxidase of monoclonal antibody to SPRR3 on formalin-fixed paraffin-embedded human tonsil. [antibody concentration 3 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol