HPA027613

S100A14 antibody from Sigma-Aldrich
BCMP84, S100A15
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA027613
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA027613, RRID:AB_10602298
Product name
Anti-S100A14 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA027613
Antibody type
Polyclonal
Antigen
S100 calcium binding protein A14 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
GQCRSANAEDAQEFSDVERAIETLIKNFHQYSVEG
GKETLTPSELRDLVTQQLPHLMPSNCGLEEKIANL
GSCNDSKLEFRSFWELIGEA
Storage
-20C
Provider Type Product Number
- No reagents -