Explore
Validate
Learn
Western blotAntibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Western blot [2]
- Immunocytochemistry [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA019592 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA019592, RRID:AB_10601499
- Product name
- Anti-S100A13
- Antibody type
- Polyclonal
- Reactivity
- Human, Rat
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
ELEESIETVVTTFFTFARQEGRKDSLSVNEFKELV
TQQLPHLLKDVGSLDEKMKSLDVNQDSELKFNEYW
RLIGELAKEIRKKKDLKI- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Differential Protein Expression Profiles of Cyst Fluid from Papillary Thyroid Carcinoma and Benign Thyroid Lesions
Proteomics analysis of melanoma metastases: association between S100A13 expression and chemotherapy resistance
Dinets A, Pernemalm M, Kjellin H, Sviatoha V, Sofiadis A, Juhlin C, Zedenius J, Larsson C, Lehtiö J, Höög A, Dumont J
PLOS ONE 2015 May;10(5)
PLOS ONE 2015 May;10(5)
Proteomics analysis of melanoma metastases: association between S100A13 expression and chemotherapy resistance
Azimi A, Pernemalm M, Frostvik Stolt M, Hansson J, Lehtiö J, Egyházi Brage S, Hertzman Johansson C
British Journal of Cancer 2014 April;110(10):2489-2495
British Journal of Cancer 2014 April;110(10):2489-2495
No comments: Submit comment
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Western blot analysis in human cell line MCF-7.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Western blot analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunofluorescent staining of human cell line U-2 OS shows localization to nucleus, plasma membrane & cytosol.
- Sample type
- HUMAN
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human thyroid gland shows strong cytoplasmic and nuclear positivity in glandular cells.
- Sample type
- HUMAN
