Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [2]
- Immunocytochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00006284-B01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00006284-B01, RRID:AB_1115337
- Product name
- S100A13 MaxPab mouse polyclonal antibody (B01)
- Antibody type
- Polyclonal
- Description
- Mouse polyclonal antibody raised against a full-length human S100A13 protein.
- Antigen sequence
MAAEPLTELEESIETVVTTFFTFARQEGRKDSLSV
NEFKELVTQQLPHLLKDVGSLDEKMKSLDVNQDSE
LKFNEYWRLIGELAKEIRKKKDLKIRKK- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of S100A13 expression in transfected 293T cell line (H00006284-T01) by S100A13 MaxPab polyclonal antibody.Lane 1: S100A13 transfected lysate(10.78 KDa).Lane 2: Non-transfected lysate.
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- S100A13 MaxPab polyclonal antibody. Western Blot analysis of S100A13 expression in HepG2.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunofluorescence of purified MaxPab antibody to S100A13 on HeLa cell. [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol