HPA019592

S100A13 antibody from MilliporeSigma / Merck KGaA
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA019592
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA019592, RRID:AB_10601499
Product name
Anti-S100A13 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA019592
Antibody type
Polyclonal
Antigen
S100 calcium binding protein A13 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
ELEESIETVVTTFFTFARQEGRKDSLSVNEFKELV
TQQLPHLLKDVGSLDEKMKSLDVNQDSELKFNEYW
RLIGELAKEIRKKKDLKI
Storage
-20C
Provider Type Product Number
- No reagents -