HPA027305

NFKB1 antibody from Atlas Antibodies
KBF1, NF-kappaB, NF-kB1, NFkappaB, NFKB-p50, p105, p50
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA027305
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA027305, RRID:AB_1854429
Product name
Anti-NFKB1
Provider product page
Atlas Antibodies - HPA027305
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
GTGSTGPGYSFPHYGFPTYGGITFHPGTTKSNAGM
KHGTMDTESKKDPEGCDKSDDKNTVNLFGKVIETT
EQDQEPSEATVGNGEVTLTYATGTKEESAGVQDNL
FLEKAMQLAKRHANALFDYAVTGDVKMLLAVQRHL
TAV
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -