H00010456-M11

HAX1 antibody from Abnova Corporation
HCLSBP1, HS1BP1
No application information provided.

Antibody data

Product number
H00010456-M11
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00010456-M11, RRID:AB_1136944
Product name
HAX1 monoclonal antibody (M11), clone 2B12
Provider product page
Abnova Corporation - H00010456-M11
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a full-length recombinant HAX1.
Antigen sequence
MSLFDLFRGFFGFPGPRSHRDPFFGGMTRDEDDDE
EEEEEGGSWGRGNPRFHSPQHPPEEFGFGFSFSPG
GGIRFHDNFGFDDLVRDFNSIFSDMGAWTLPSHPP
ELPGPESETPGERLREGQTLRDSMLKYPDSHQPRI
FGGVLESDARSESPQPAPDWGSQRPFHRFDDVWPM
DPHPRTREDNDLDSQVSQEGLGPVLQPQPKSYFKS
ISVTKITKPDGIVEERRTVVDSEGRTETTVTRHEA
DSSPRGDPESPRPPALDDAFSILDLFLGRWFRSR
Isotype
IgG
Antibody clone number
2B12
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -