Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN503141 - Provider product page

- Provider
- antibodies-online
- Product name
- anti-Aquaporin 10 (AQP10) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-AQP10 antibody: synthetic peptide directed towards the middle region of human AQP10
- Description
- Affinity Purified
- Reactivity
- Human, Canine
- Host
- Rabbit
- Antigen sequence
VGATVGTATYQLLVALHHPEGPEPAQDLVSAQHKA
SELET PASAQMLECK- Epitope
- Middle Region
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Expression and localization of two isoforms of AQP10 in human small intestine.
Li H, Kamiie J, Morishita Y, Yoshida Y, Yaoita E, Ishibashi K, Yamamoto T
Biology of the cell / under the auspices of the European Cell Biology Organization 2005 Nov;97(11):823-9
Biology of the cell / under the auspices of the European Cell Biology Organization 2005 Nov;97(11):823-9
No comments: Submit comment
No validations: Submit validation data