HPA028390

TDRD10 antibody from MilliporeSigma / Merck KGaA
DKFZp434M202
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA028390
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA028390, RRID:AB_10601820
Product name
Anti-TDRD10 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA028390
Antibody type
Polyclonal
Antigen
tudor domain containing 10 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LLVTSIVPKTPFFWAMHVTEALHQNMQALFSTLAQ
AEEQQPYLEGSTVMRGTRCLAEYHLGDYGHAWNRC
WVLDRVDTWAV
Storage
-20C
Provider Type Product Number
- No reagents -