H00055585-B01

UBE2Q1 antibody from Abnova Corporation
NICE-5, PRO3094, UBE2Q

Antibody data

Product number
H00055585-B01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00055585-B01, RRID:AB_1116028
Product name
UBE2Q1 MaxPab mouse polyclonal antibody (B01)
Provider product page
Abnova Corporation - H00055585-B01
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human UBE2Q1 protein.
Antigen sequence
MELLTKQGWSSAYSIESVIMQISATLVKGKARVQF
GANKSQYSLTRAQQSYKSLVQIHEKNGWYTPPKED
G
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -