HPA029900

PMVK antibody from MilliporeSigma / Merck KGaA
HUMPMKI, PMK, PMKA
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA029900
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA029900, RRID:AB_10601390
Product name
Anti-PMVK antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA029900
Antibody type
Polyclonal
Antigen
phosphomevalonate kinase recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
PRLVLLFSGKRKSGKDFVTEALQSRLGADVCAVLR
LSGPLKEQYAQEHGLNFQRLLDTSTYKEAFRKDMI
RWGEEKRQADPGFFCRKIVEG
Storage
-20C
Provider Type Product Number
- No reagents -