H00079800-B01P

CARF antibody from Abnova Corporation
ALS2CR8, CaRF, FLJ21579, NYD-SP24

Antibody data

Product number
H00079800-B01P
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00079800-B01P, RRID:AB_1571160
Product name
ALS2CR8 purified MaxPab mouse polyclonal antibody (B01P)
Provider product page
Abnova Corporation - H00079800-B01P
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human ALS2CR8 protein.
Antigen sequence
MEQSNDSLRVNHNDGEESKTSAQVFEHLICMDSRD
SSFGQNDSPTVLPITTREANNSLISQNIPGPLTQT
QTLSAEQFHLVDQNGQAIQYELQSLGESNAQMMIV
ASPTENGQVLRVIPPTQTGMAQVIIPQGQLVDVNS
PRDVPEEKPSNRNLPTVRVDTLADNTSNYILHPQT
SFPLPKKSVTGMLEEPLLGPLQPLSSNTPIWACRL
RSCEKIGDSYRGYCVSETELESVLTFHKQQTQSVW
GTRQSPSPAKPATRLMWKSQYVPYDGIPFVNAGSR
AVVMECQYGPRRKGFQLKKVSEQESRSCQLYKATC
PARIYIKKVQKFPEYRVPTDPKIDKKIIRMEQEKA
FNMLKKNLVDAGGVLRWYVQLPTQQAHQYHELETP
CLTLSPSPFPVSSLEEEETAVRDENCALPSRLHPQ
VAHKIQELVSQGIEQVYAVRKQLRKFVERELFKPD
EVPERHNLSFFPTVNDIKNHIHEVQKSLRNGDTVY
NSEIIPATLQWTTDSGNILKETMTVTFAEGNSPGE
SITTKVETNQTRGSLSPEPTHLLSSLSSFQPKIFT
QLQGLQLQPRYTSPDESPAVVSVNNQPSSSPSGLL
DTIGSAVMNNNSLLLGQSHSLQRDTCLTQNNSTAS
TMGNLPEPDQNLVAMDELVEVGDVEDTGNLEGTVH
RILLGDVQTIPIQIIDNHSALIEENPESTISVSQV
KQEPKEPALSMEAKNCGL
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -