HPA034557

CARF antibody from MilliporeSigma / Merck KGaA
ALS2CR8, CaRF, FLJ21579, NYD-SP24
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA034557
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA034557, RRID:AB_10601663
Product name
Anti-ALS2CR8 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA034557
Antibody type
Polyclonal
Antigen
amyotrophic lateral sclerosis 2 (juvenile) chromosome region, candidate 8 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SQGIEQVYAVRKQLRKFVERELFKPDEVPERHNLS
FFPTVNDIKNHIHEVQKSLRNGDTVYNSEIIPATL
QWTTDSGNILKETMTVTFAEGNSPGESITTK
Storage
-20C
Provider Type Product Number
- No reagents -