H00005519-B01P

PPP2R1B antibody from Abnova Corporation
PP2A-Abeta, PR65B

Antibody data

Product number
H00005519-B01P
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00005519-B01P, RRID:AB_1204825
Product name
PPP2R1B purified MaxPab mouse polyclonal antibody (B01P)
Provider product page
Abnova Corporation - H00005519-B01P
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human PPP2R1B protein.
Antigen sequence
MAGASELGTGPGAAGGDGDDSLYPIAVLIDELRNE
DVQLRLNSIKKLSTIALALGVERTRSELLPFLTDT
IYDEDEVLLALAEQLGNFTGLVGGPDFAHCLLPPL
ENLATVEETVVRDKAVESLRQISQEHTPVALEAYF
VPLVKRLASGDWFTSRTSACGLFSVCYPRASNAVK
AEIRQQFRSLCSDDTPMVRRAAASKLGEFAKVLEL
DSVKSEIVPLFTSLASDEQDSVRLLAVEACVSIAQ
LLSQDDLETLVMPTLRQAAEDKSWRVRYMVADRFS
ELQKAMGPKITLNDLIPAFQNLLKDCEAEVRAAAA
HKVKELGENLPIEDRETIIMNQILPYIKELVSDTN
QHVKSALASVIMGLSTILGKENTIEHLLPLFLAQL
KDECPDVRLNIISNLDCVNEVIGIRQLSQSLLPAI
VELAEDAKWRVRLAIIEYMPLLAGQLGVEFFDEKL
NSLCMAWLVDHVYAIREAATNNLMKLVQKFGTEWA
QNTIVPKVLVMANDPNYLHRMTTLFCINALSEACG
QEITTKQMLPIVLKMAGDQVANVRFNVAKSLQKIG
PILDTNALQGEVKPVLQKLGQDEDMDVKYFAQEAI
SVLALA
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -