HPA018908

PPP2R1B antibody from Atlas Antibodies
PP2A-Abeta, PR65B
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA018908
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA018908, RRID:AB_1855655
Product name
Anti-PPP2R1B
Provider product page
Atlas Antibodies - HPA018908
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
NALQGEVKPVLQKLGQDEDMDVKYFAQEAISVVAQ
RLRKLEFPVKDSGEPSVPRADKNHFPRPTVPGEDM
GKGPVYQLRGDTRDTLAQLGIAELVHFSQSTD
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -