HPA049447

NBEAL1 antibody from Atlas Antibodies
ALS2CR16, ALS2CR17, MGC164581

Antibody data

Product number
HPA049447
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA049447, RRID:AB_2680771
Product name
Anti-NBEAL1
Provider product page
Atlas Antibodies - HPA049447
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
TIPNLAISWEGHIVVYSSTEEKTTLKDKNALHLFS
INGKYLGSQILKEQVSDICIIGEHIVTGSIQGFLS
IRDLHSLNLSINPLAMRLPIHCVCVTKEYS
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.