HPA006293

THBS3 antibody from MilliporeSigma / Merck KGaA
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA006293
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA006293, RRID:AB_10602898
Product name
Anti-THBS3 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA006293
Antibody type
Polyclonal
Antigen
thrombospondin 3 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
TVGESRQMVAVAEKIRTALLTAGDIYLLSTFRLPP
KQGGVLFGLYSRQDNTRWLEASVVGKINKVLVRYQ
REDGKVHAVNLQQAGLADGRTHTVLLRLRGPSRPS
PALHLYVDCKLGDQHAGLPALAPIPPAEVDGLEIR
TG
Storage
-20C
Provider Type Product Number
- No reagents -