Antibody data

Product number
H00001933-M10
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00001933-M10, RRID:AB_1204300
Product name
EEF1B2 monoclonal antibody (M10), clone 3A5
Provider product page
Abnova Corporation - H00001933-M10
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant EEF1B2.
Antigen sequence
VPSQADVAVFEAVSSPPPADLCHALRWYNHIKSYE
KEKASLPGVKKALGKYGPADVEDTTGSG
Isotype
IgG
Antibody clone number
3A5
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -