Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00001933-M10 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00001933-M10, RRID:AB_1204300
- Product name
- EEF1B2 monoclonal antibody (M10), clone 3A5
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant EEF1B2.
- Antigen sequence
VPSQADVAVFEAVSSPPPADLCHALRWYNHIKSYE
KEKASLPGVKKALGKYGPADVEDTTGSG- Isotype
- IgG
- Antibody clone number
- 3A5
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Independent overexpression of the subunits of translation elongation factor complex eEF1H in human lung cancer.
Veremieva M, Kapustian L, Khoruzhenko A, Zakharychev V, Negrutskii B, El'skaya A
BMC cancer 2014 Dec 3;14:913
BMC cancer 2014 Dec 3;14:913
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- EEF1B2 monoclonal antibody (M10), clone 3A5. Western Blot analysis of EEF1B2 expression in HeLa ( Cat # L013V1 ).