Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA012130 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA012130, RRID:AB_10600973
- Product name
- Anti-ADAM23
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
LLVLLLLPPLAASSRPRAWGAAAPSAPHWNETAEK
NLGVLADEDNTLQQNSSSNISYSNAMQKEITLPSR
LIYYINQDSESPYHVLDTKARHQQKHNKAVHLAQA
SFQIEAFGSKFILD- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references A novel program of infiltrative control in astrocytomas: ADAM23 depletion promotes cell invasion by activating γ-secretase complex
Intratumoral heterogeneity of ADAM23 promotes tumor growth and metastasis through LGI4 and nitric oxide signals
Jandrey E, Barnabé G, Maldaun M, Asprino P, dos Santos N, Inoue L, Rozanski A, Galante P, Marie S, Oba-Shinjo S, dos Santos T, Chammas R, Lancellotti C, Furnari F, Camargo A, Costa É
Neuro-Oncology Advances 2023;5(1)
Neuro-Oncology Advances 2023;5(1)
Intratumoral heterogeneity of ADAM23 promotes tumor growth and metastasis through LGI4 and nitric oxide signals
Costa E, Barnabé G, Li M, Dias A, Machado T, Asprino P, Cavalher F, Ferreira E, del Mar Inda M, Nagai M, Malnic B, Duarte M, Leite K, de Barros A, Carraro D, Chammas R, Armelin H, Cavenee W, Furnari F, Camargo A
Oncogene 2014;34(10):1270-1279
Oncogene 2014;34(10):1270-1279
No comments: Submit comment
No validations: Submit validation data