HPA028200

FDPS antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA028200
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA028200, RRID:AB_10612109
Product name
Anti-FDPS antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA028200
Antibody type
Polyclonal
Antigen
farnesyl diphosphate synthase (farnesyl pyrophosphate synthetase, dimethylallyltranstransferase, geranyltranstransferase) recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SLVHGYPVLAWHSARCWCQAWTEEPRALCSSLRMN
GDQNSDVYAQEKQDFVQHFSQIVRVLTEDEMGHPE
IGDAIARLKEVLEYNAIGGKYN
Storage
-20C
Provider Type Product Number
- No reagents -