HPA035046

PLEKHM3 antibody from MilliporeSigma / Merck KGaA
DAPR, PLEKHM1L
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA035046
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA035046, RRID:AB_10603128
Product name
Anti-PLEKHM3 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA035046
Antibody type
Polyclonal
Antigen
pleckstrin homology domain containing, family M, member 3 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
MIWDHCKSRLLETKAQNVFPAKEQFMVQRGTTPDN
LSWMEQKEASTFNFFNICQRRRDRPRSVNDLLDET
STFKPGHARSRSDITQVD
Storage
-20C
Provider Type Product Number
- No reagents -