Antibody data

Product number
H00001421-D01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00001421-D01, RRID:AB_10717218
Product name
CRYGD MaxPab rabbit polyclonal antibody (D01)
Provider product page
Abnova Corporation - H00001421-D01
Antibody type
Polyclonal
Description
Rabbit polyclonal antibody raised against a full-length human CRYGD protein.
Antigen sequence
MGKITLYEDRGFQGRHYECSSDHPNLQPYLSRCNS
ARVDSGCWMLYEQPNYSGLQYFLRRGDYADHQQWM
GLSDSVRSCRLIPHSGSHRIRLYEREDYRGQMIEF
TEDCSCLQDRFRFNEIHSLNVLEGSWVLYELSNYR
GRQYLLMPGDYRRYQDWGATNARVGSLRRVIDFS
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.