H00001420-M01A

CRYGC antibody from Abnova Corporation
CRYG3
No application information provided.

Antibody data

Product number
H00001420-M01A
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00001420-M01A, RRID:AB_1204204
Product name
CRYGC monoclonal antibody (M01A), clone 7C4
Provider product page
Abnova Corporation - H00001420-M01A
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant CRYGC.
Antigen sequence
SIRSCCLIPQTVSHRLRLYEREDHKGLMMELSEDC
PSIQDRFHLSEIRSLHVLEGCWVLYELPNYRGRQY
LLRPQEYRRCQDWGAMDAKAGSLRRVVDLY
Isotype
IgG
Antibody clone number
7C4
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -