HPA006986

YY1AP1 antibody from Sigma-Aldrich
HCCA2, YAP, YY1AP
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA006986
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA006986, RRID:AB_1080620
Product name
Anti-YY1AP1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA006986
Antibody type
Polyclonal
Antigen
YY1-associated protein 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
MEDDGPEEEERVAEPQANFNTPQALRFEELLANLL
NEQHQIAKELFEQLKMKKPSAKQQKEVEKVKPQCK
EVHQTLILDPAQRKRLQQQMQQHVQLLTQIHLLAT
CNPNLNPEASSTRICLKELGTFAQSSIA
Storage
-20C
Provider Type Product Number
- No reagents -