PAB28478
antibody from Abnova Corporation
Targeting: DLG3
KIAA1232, MRX90, NE-Dlg, NEDLG, PPP1R82, SAP-102, SAP102
Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- Immunocytochemistry [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- PAB28478 - Provider product page

- Provider
- Abnova Corporation
- Product name
- DLG3 polyclonal antibody
- Antibody type
- Polyclonal
- Description
- Rabbit polyclonal antibody raised against recombinant DLG3
- Antigen sequence
HKHQHCCKCPECYEVTRLAALRRLEPPGYGDWQVP
DPYGPGGGNGASAGYGGYSSQTLPSQAGATPTPRT
KAKLIPTGRDVGPVPPKPVPGKSTPKLNGSGPSWW
PECTCTNRDWYEQVNGSD- Isotype
- IgG
- Storage
- Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western blot analysis of Lane 1: Negative control (vector only transfected HEK293T lysate), Lane 2: Over-expression Lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells) with DLG3 polyclonal antibody at 1:100-1:250 dilution.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunofluorescent staining of human cell line U-2 OS with DLG3 polyclonal antibody (Cat # PAB28478) at 1-4 ug/ml shows positivity in nucleus & nucleoli.
- Validation comment
- Immunofluorescence
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunohistochemical staining of human cerebral cortex with DLG3 polyclonal antibody (Cat # PAB28478) shows distinct nuclear and cytoplasmic positivity in neuronal cells at 1:50-1:200 dilution.
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)