ABIN635101

antibody from antibodies-online

Targeting: DLG3 KIAA1232, MRX90, NE-Dlg, NEDLG, PPP1R82, SAP-102, SAP102

Western blot

Antibody data

Submit

Validation data

Product number: ABIN635101 - Provider product page
Provider: antibodies-online
Product name: anti-Discs, Large Homolog 3 (Drosophila) (DLG3) antibody
Antibody type: Polyclonal
Antigen: DLG3 antibody was raised using a synthetic peptide corresponding to a region with amino acids FPHKFGSCVPHTTRPRRDNEVDGQDYHFVVSREQMEKDIQDNKFIEAGQF
Description: Affinity purified
Reactivity: Human, Mouse, Rat
Host: Rabbit
Vial size: 50 μg
Concentration: 1 mg/mL
Storage: Store at 2-8°C for short periods. For longer periods of storage, store at -20°C.
Handling: Avoid repeated freeze/thaw cycles.

DLG3 protein structure - ABIN635101 shown in red.