HPA001733

DLG3 antibody from Atlas Antibodies
KIAA1232, MRX90, NE-Dlg, NEDLG, PPP1R82, SAP-102, SAP102
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA001733
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA001733, RRID:AB_1078675
Product name
Anti-DLG3
Provider product page
Atlas Antibodies - HPA001733
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
HKHQHCCKCPECYEVTRLAALRRLEPPGYGDWQVP
DPYGPGGGNGASAGYGGYSSQTLPSQAGATPTPRT
KAKLIPTGRDVGPVPPKPVPGKSTPKLNGSGPSWW
PECTCTNRDWYEQVNGSD
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -