Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00010314-A01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00010314-A01, RRID:AB_462007
- Product name
- LANCL1 polyclonal antibody (A01)
- Antibody type
- Polyclonal
- Description
- Mouse polyclonal antibody raised against a partial recombinant LANCL1.
- Antigen sequence
MAQRAFPNPYADYNKSLAEGYFDAAGRLTPEFSQR
LTNKIRELLQQMERGLKSADPRD- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Lanthionine synthetase C-like protein 2 (LanCL2) is a novel regulator of Akt.
Lanthionine synthetase C-like protein 1 interacts with and inhibits cystathionine β-synthase: a target for neuronal antioxidant defense.
Zeng M, van der Donk WA, Chen J
Molecular biology of the cell 2014 Dec 1;25(24):3954-61
Molecular biology of the cell 2014 Dec 1;25(24):3954-61
Lanthionine synthetase C-like protein 1 interacts with and inhibits cystathionine β-synthase: a target for neuronal antioxidant defense.
Zhong WX, Wang YB, Peng L, Ge XZ, Zhang J, Liu SS, Zhang XN, Xu ZH, Chen Z, Luo JH
The Journal of biological chemistry 2012 Oct 5;287(41):34189-201
The Journal of biological chemistry 2012 Oct 5;287(41):34189-201
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- LANCL1 polyclonal antibody (A01), Lot # 050914JC01. Western Blot analysis of LANCL1 expression in human ovarian cancer.