H00023381-B01

SMG5 antibody from Abnova Corporation
EST1B, KIAA1089, LPTS-RP1, LPTSRP1, RP11-54H19.7, SMG-5

Antibody data

Product number
H00023381-B01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00023381-B01, RRID:AB_1138945
Product name
EST1B MaxPab mouse polyclonal antibody (B01)
Provider product page
Abnova Corporation - H00023381-B01
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human EST1B protein.
Antigen sequence
MSQGPPTGESSEPEAKVLHTKRLYRAVVEAVHRLD
LILCNKTAYQEVFKPENISLRNKLRELCVKLMFLH
PVDYGRKAEELLWRKVYYEVIQLIKTNKKHIHSRS
TLECAYRTHLVAGIGFYQHLLLYIQSHYQLELQCC
IDWTHVTDPLIGCKKPVSASGKEMDWAQMACHRCL
VYLGDLSRYQNELAGVDTELLAERFYYQALSVAPQ
IGMPFNQLGTLAGSKYYNVEAMYCYLRCIQSEVSF
EGAYGNLKRLYDKAAKMYHQLKKCETRKLSPGKKR
CKDIKRLLVNFMYLQSLLQPKSSSVDSELTSLCQS
VLEDFNLCLFYLPSSPNLSLASEDEEEYESGYAFL
PDLLIFQMVIICLMCVHSLERAGSKQYSAAIAFTL
ALFSHLVNHVNIRLQAELEEGENPVPAFQSDGTDE
PESKEPVEKEEEPDPEPPPVTPQVGEGRKSRKFSR
LSCLRRRRHPPKVGDDSDLSEGFESDSSHDSARAS
EGSDSGSDKSLEGGGTAFDAETDSEMNSQESRSDL
EDMEEEEGTRSPTLEPPRGRSEAPDSLNGPLGPSE
ASIASNLQAMSTQMFQTKRCFRLAPTFSNLLLQPT
TNPHTSASHRPCVNGDVDKPSEPASEEGSESEGSE
SSGRSCRNERSIQEKLQVLMAEGLLPAVKVFLDWL
RTNPDLIIVCAQSSQSLWNRLSVLLNLLPAAGELQ
ESGLALCPEVQDLLEGCELPDLPSSLLLPEDMALR
NLPPLRAAHRRFNFDTDRPLLSTLEESVVRICCIR
SFGHFIARLQGSILQFNPEVGIFVSIAQSEQESLL
QQAQAQFRMAQEEARRNRLMRDMAQLRLQLEVSQL
EGSLQQPKAQSAMSPYLVPDTQALCHHLPVIRQLA
TSGRFIVIIPRTVIDGLDLLKKEHPGARDGIRYLE
AEFKKGNRYIRCQKEVGKSFERHKLKRQDADAWTL
YKILDSCKQLTLAQGAGEEDPSGMVTIITGLPLDN
PSVLSGPMQAALQAAAHASVDIKDVLDFYKQWKEI
G
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -