Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [2]
- Immunocytochemistry [1]
- Immunohistochemistry [7]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA059142 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA059142, RRID:AB_2683923
- Product name
- Anti-IKZF2
- Antibody type
- Polyclonal
- Description
- Affinity purified using the PrEST antigen as affinity ligand
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
CLDSTDSESSHDDHQSYQGHPALNPKRKQSPAYMK
EDVKALDTTKAPKGSLKDIYKVFNGEGEQIR- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
No comments: Submit comment
Enhanced validation
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Orthogonal validation
- Main image
- Experimental details
- Western blot analysis in human cell line RT-4 and human cell line SK-MEL-30.
- Sample type
- HUMAN
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Human cell line RT-4Lane 3: Human cell line U-251MG sp
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunofluorescent staining of human cell line RT4 shows localization to nucleoplasm.
- Sample type
- HUMAN
Enhanced validation
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Orthogonal validation
- Main image
- Experimental details
- Immunohistochemistry analysis in human esophagus and cerebral cortex tissues using HPA059142 antibody. Corresponding IKZF2 RNA-seq data are presented for the same tissues.
- Sample type
- HUMAN
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human colon shows strong nuclear positivity in glandular cells.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human esophagus shows moderate to strong nuclear positivity in squamous epithelial cells.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human lymphoid tissues shows moderate to strong nuclear positivity in lymphoid cells.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human squamous epithelia shows moderate to strong nuclear positivity in squamous epithelial cells.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human prostate shows moderate to strong nuclear positivity in glandular cells.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human cerebral cortex shows no positivity in neurons as expected.
- Sample type
- HUMAN