HPA028149

TSACC antibody from Sigma-Aldrich
C1orf182, SIP, SSTK-IP
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA028149
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA028149, RRID:AB_10601147
Product name
Anti-C1orf182 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA028149
Antibody type
Polyclonal
Antigen
Uncharacterized protein C1orf182 (SSTK-interacting protein)(SSTK-IP) recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LLECMYANLQLQTQLAQQQMAVLEHLQASVTQLAP
GRGSNNSSLPALSPNPLLNHLPQFSK
Storage
-20C
Provider Type Product Number
- No reagents -